Lineage for d3jtca_ (3jtc A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2506505Family d.19.1.1: MHC antigen-recognition domain [54453] (13 protein domains)
  6. 2507461Protein automated matches [191280] (4 species)
    not a true protein
  7. 2507471Species Human (Homo sapiens) [TaxId:9606] [189896] (25 PDB entries)
  8. 2507474Domain d3jtca_: 3jtc A: [178819]
    Other proteins in same PDB: d3jtcc_, d3jtcd_
    automated match to d1lqvb_
    complexed with ca, mg, nag, ndg, pty

Details for d3jtca_

PDB Entry: 3jtc (more details), 1.6 Å

PDB Description: Importance of Mg2+ in the Ca2+-Dependent Folding of the gamma-Carboxyglutamic Acid Domains of Vitamin K-Dependent clotting and anticlotting Proteins
PDB Compounds: (A:) Endothelial protein C receptor

SCOPe Domain Sequences for d3jtca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jtca_ d.19.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glqrlhmlqisyfrdpyhvwyqgnaslgghlthvlegpdtnttiiqlqplqepeswartq
sglqsyllqfhglvrlvhqertlafpltircflgcelppegsrahvffevavngssfvsf
rperalwqadtqvtsgvvtftlqqlnaynrtryelrefledtcvqyvqkhis

SCOPe Domain Coordinates for d3jtca_:

Click to download the PDB-style file with coordinates for d3jtca_.
(The format of our PDB-style files is described here.)

Timeline for d3jtca_: