SCOPe 2.08: Domain d3jswa1: 3jsw A:182-505

Lineage for d3jswa1 (3jsw A:182-505)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A [109942] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109943] (22 PDB entries)
   Uniprot O76083 241-566

8. Domain d3jswa1: 3jsw A:182-505 [178795]
   Other proteins in same PDB: d3jswa2, d3jswb2
   automated match to d2hd1a1
   complexed with jar, mg, zn

Details for d3jswa1

PDB Entry: 3jsw, 2.3 Å

PDB Description: human pde9 in complex with selective inhibitor

PDB Compounds: (A:) High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A

SCOPe Domain Sequences for d3jswa1:

Sequence; same for both SEQRES and ATOM records:

>d3jswa1 a.211.1.2 (A:182-505) High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A {Human (Homo sapiens) [TaxId: 9606]}
typkyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrrwlfc
vhdnyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhpgynn
tyqinartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmitlil
atdmarhaeimdsfkekmenfdysneehmtllkmilikccdisnevrpmevaepwvdcll
eeyfmqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfpmveeimlq
plwesrdryeelkriddamkelqk

Timeline for d3jswa1:

• d3jswa1 first appeared in SCOPe 2.01, called d3jswa_
  
• d3jswa1 appears in SCOPe 2.07