Lineage for d3jswa1 (3jsw A:182-505)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2349642Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2349643Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2349733Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2350040Protein High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A [109942] (2 species)
  7. 2350044Species Human (Homo sapiens) [TaxId:9606] [109943] (22 PDB entries)
    Uniprot O76083 241-566
  8. 2350075Domain d3jswa1: 3jsw A:182-505 [178795]
    Other proteins in same PDB: d3jswa2, d3jswb2
    automated match to d2hd1a1
    complexed with jar, mg, zn

Details for d3jswa1

PDB Entry: 3jsw (more details), 2.3 Å

PDB Description: human pde9 in complex with selective inhibitor
PDB Compounds: (A:) High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A

SCOPe Domain Sequences for d3jswa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jswa1 a.211.1.2 (A:182-505) High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A {Human (Homo sapiens) [TaxId: 9606]}
typkyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrrwlfc
vhdnyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhpgynn
tyqinartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmitlil
atdmarhaeimdsfkekmenfdysneehmtllkmilikccdisnevrpmevaepwvdcll
eeyfmqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfpmveeimlq
plwesrdryeelkriddamkelqk

SCOPe Domain Coordinates for d3jswa1:

Click to download the PDB-style file with coordinates for d3jswa1.
(The format of our PDB-style files is described here.)

Timeline for d3jswa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3jswa2