SCOPe 2.07: Domain d3js1b_: 3js1 B:

Lineage for d3js1b_ (3js1 B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Adipocyte lipid-binding protein, ALBP [50856] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [50857] (21 PDB entries)

8. Domain d3js1b_: 3js1 B: [178747]
   automated match to d1a18a_
   complexed with po4

Details for d3js1b_

PDB Entry: 3js1, 1.81 Å

PDB Description: Crystal structure of adipocyte fatty acid binding protein covalently modified with 4-hydroxy-2-nonenal

PDB Compounds: (B:) Adipocyte fatty acid-binding protein

SCOPe Domain Sequences for d3js1b_:

Sequence; same for both SEQRES and ATOM records:

>d3js1b_ b.60.1.2 (B:) Adipocyte lipid-binding protein, ALBP {Mouse (Mus musculus) [TaxId: 10090]}
cdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdlvtirsestfknt
eisfklgvefdeitaddrkvksiitldggalvqvqkwdgksttikrkrdgdklvvexvmk
gvtstrvyera

Timeline for d3js1b_:

• d3js1b_ first appeared in SCOPe 2.01
  
• d3js1b_ appears in SCOPe 2.06
  
• d3js1b_ appears in the current release, SCOPe 2.08