PDB entry 3js1

View 3js1 on RCSB PDB site
Description: Crystal structure of adipocyte fatty acid binding protein covalently modified with 4-hydroxy-2-nonenal
Class: lipid binding protein
Keywords: lipid binding protein, fatty acid binding protein, 4-hydroxy-2-nonenal modified cysteine
Deposited on 2009-09-09, released 2010-08-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-08-25, with a file datestamp of 2010-08-20.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.198
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adipocyte fatty acid-binding protein
    Species: Mus musculus [TaxId:10090]
    Gene: Fabp4, Ap2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3js1a_
  • Chain 'B':
    Compound: Adipocyte fatty acid-binding protein
    Species: Mus musculus [TaxId:10090]
    Gene: Fabp4, Ap2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3js1b_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3js1A (A:)
    cdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdlvtirsestfknt
    eisfklgvefdeitaddrkvksiitldggalvqvqkwdgksttikrkrdgdklvvexvmk
    gvtstrvyera
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3js1B (B:)
    cdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdlvtirsestfknt
    eisfklgvefdeitaddrkvksiitldggalvqvqkwdgksttikrkrdgdklvvexvmk
    gvtstrvyera