Class b: All beta proteins [48724] (178 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
Protein Adipocyte lipid-binding protein, ALBP [50856] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [50857] (21 PDB entries) |
Domain d3js1a_: 3js1 A: [178746] automated match to d1a18a_ complexed with po4 |
PDB Entry: 3js1 (more details), 1.81 Å
SCOPe Domain Sequences for d3js1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3js1a_ b.60.1.2 (A:) Adipocyte lipid-binding protein, ALBP {Mouse (Mus musculus) [TaxId: 10090]} cdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdlvtirsestfknt eisfklgvefdeitaddrkvksiitldggalvqvqkwdgksttikrkrdgdklvvexvmk gvtstrvyera
Timeline for d3js1a_: