SCOPe 2.02: Domain d3igsb_: 3igs B:

Lineage for d3igsb_ (3igs B:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.0: automated matches [191350] (1 protein)
   not a true family

6. Protein automated matches [190292] (10 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:90371] [189019] (2 PDB entries)

8. Domain d3igsb_: 3igs B: [178316]
   automated match to d1yxya1
   complexed with 16g, cl, so4

Details for d3igsb_

PDB Entry: 3igs, 1.5 Å

PDB Description: structure of the salmonella enterica n-acetylmannosamine-6-phosphate 2-epimerase

PDB Compounds: (B:) N-acetylmannosamine-6-phosphate 2-epimerase 2

SCOPe Domain Sequences for d3igsb_:

Sequence; same for both SEQRES and ATOM records:

>d3igsb_ c.1.2.0 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]}
snamslleqldkniaasgglivscqpvpgspldkpeivaamalaaeqagavavriegidn
lrmtrslvsvpiigiikrdldespvritpflddvdalaqagaaiiavdgtarqrpvavea
llarihhhhlltmadcssvddglacqrlgadiigttmsgyttpdtpeepdlplvkalhda
gcrviaegrynspalaaeairygawavtvgsaitrlehicgwyndalkkaas

Timeline for d3igsb_:

• d3igsb_ first appeared in SCOPe 2.01
  
• d3igsb_ appears in SCOPe 2.03
  
• d3igsb_ appears in the current release, SCOPe 2.08, called d3igsb1