Lineage for d3igsa_ (3igs A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1143706Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1144315Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 1144316Protein automated matches [190292] (10 species)
    not a true protein
  7. 1144350Species Salmonella typhimurium [TaxId:90371] [189019] (2 PDB entries)
  8. 1144351Domain d3igsa_: 3igs A: [178315]
    automated match to d1yxya1
    complexed with 16g, cl, so4

Details for d3igsa_

PDB Entry: 3igs (more details), 1.5 Å

PDB Description: structure of the salmonella enterica n-acetylmannosamine-6-phosphate 2-epimerase
PDB Compounds: (A:) N-acetylmannosamine-6-phosphate 2-epimerase 2

SCOPe Domain Sequences for d3igsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3igsa_ c.1.2.0 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]}
amslleqldkniaasgglivscqpvpgspldkpeivaamalaaeqagavavriegidnlr
mtrslvsvpiigiikrdldespvritpflddvdalaqagaaiiavdgtarqrpvaveall
arihhhhlltmadcssvddglacqrlgadiigttmsgyttpdtpeepdlplvkalhdagc
rviaegrynspalaaeairygawavtvgsaitrlehicgwyndalkkaas

SCOPe Domain Coordinates for d3igsa_:

Click to download the PDB-style file with coordinates for d3igsa_.
(The format of our PDB-style files is described here.)

Timeline for d3igsa_: