Lineage for d3iekb_ (3iek B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2997182Family d.157.1.10: beta-CASP RNA-metabolising hydrolases [143927] (4 proteins)
    contains insertion of a single helicase-like alpha/beta domain (from (52540)) but without the P-loop motif
  6. 2997196Protein Putative RNA-degradation protein TTHA0252 [160854] (1 species)
  7. 2997197Species Thermus thermophilus [TaxId:274] [160855] (14 PDB entries)
    Uniprot Q5SLP1 1-431
  8. 2997203Domain d3iekb_: 3iek B: [178274]
    automated match to d2dkfa1
    complexed with flc, so4, zn

Details for d3iekb_

PDB Entry: 3iek (more details), 2.05 Å

PDB Description: crystal structure of native ttha0252 from thermus thermophilus hb8
PDB Compounds: (B:) Ribonuclease TTHA0252

SCOPe Domain Sequences for d3iekb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iekb_ d.157.1.10 (B:) Putative RNA-degradation protein TTHA0252 {Thermus thermophilus [TaxId: 274]}
mrivpfgaarevtgsahlllaggrrvlldcgmfqgkeearnhapfgfdpkevdavlltha
hldhvgrlpklfregyrgpvyatratvllmeivledalkvmdepffgpedveealghlrp
leygewlrlgalslafgqaghlpgsafvvaqgegrtlvysgdlgnrekdvlpdpslppla
dlvlaegtygdrphrpyretvrefleilektlsqggkvliptfaveraqeilyvlythgh
rlprapiyldspmagrvlslyprlvryfseevqahflqgknpfrpaglevvehteaskal
nrapgpmvvlagsgmlaggrilhhlkhglsdprnalvfvgyqpqgglgaeiiarppavri
lgeevplrasvhtlggfsghagqdelldwlqgeprvvlvhgeeekllalgkllalrgqev
slarfgegvpv

SCOPe Domain Coordinates for d3iekb_:

Click to download the PDB-style file with coordinates for d3iekb_.
(The format of our PDB-style files is described here.)

Timeline for d3iekb_: