Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) |
Family d.157.1.10: beta-CASP RNA-metabolising hydrolases [143927] (4 proteins) contains insertion of a single helicase-like alpha/beta domain (from (52540)) but without the P-loop motif |
Protein Putative RNA-degradation protein TTHA0252 [160854] (1 species) |
Species Thermus thermophilus [TaxId:274] [160855] (14 PDB entries) Uniprot Q5SLP1 1-431 |
Domain d3iekb_: 3iek B: [178274] automated match to d2dkfa1 complexed with flc, so4, zn |
PDB Entry: 3iek (more details), 2.05 Å
SCOPe Domain Sequences for d3iekb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iekb_ d.157.1.10 (B:) Putative RNA-degradation protein TTHA0252 {Thermus thermophilus [TaxId: 274]} mrivpfgaarevtgsahlllaggrrvlldcgmfqgkeearnhapfgfdpkevdavlltha hldhvgrlpklfregyrgpvyatratvllmeivledalkvmdepffgpedveealghlrp leygewlrlgalslafgqaghlpgsafvvaqgegrtlvysgdlgnrekdvlpdpslppla dlvlaegtygdrphrpyretvrefleilektlsqggkvliptfaveraqeilyvlythgh rlprapiyldspmagrvlslyprlvryfseevqahflqgknpfrpaglevvehteaskal nrapgpmvvlagsgmlaggrilhhlkhglsdprnalvfvgyqpqgglgaeiiarppavri lgeevplrasvhtlggfsghagqdelldwlqgeprvvlvhgeeekllalgkllalrgqev slarfgegvpv
Timeline for d3iekb_: