Lineage for d2dkfa1 (2dkf A:1-431)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2997182Family d.157.1.10: beta-CASP RNA-metabolising hydrolases [143927] (4 proteins)
    contains insertion of a single helicase-like alpha/beta domain (from (52540)) but without the P-loop motif
  6. 2997196Protein Putative RNA-degradation protein TTHA0252 [160854] (1 species)
  7. 2997197Species Thermus thermophilus [TaxId:274] [160855] (14 PDB entries)
    Uniprot Q5SLP1 1-431
  8. 2997230Domain d2dkfa1: 2dkf A:1-431 [146536]
    complexed with zn

Details for d2dkfa1

PDB Entry: 2dkf (more details), 2.8 Å

PDB Description: Crystal Structure of TTHA0252 from Thermus thermophilus HB8, a RNA Degradation Protein of the Metallo-beta-lactamase Superfamily
PDB Compounds: (A:) metallo-beta-lactamase superfamily protein

SCOPe Domain Sequences for d2dkfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dkfa1 d.157.1.10 (A:1-431) Putative RNA-degradation protein TTHA0252 {Thermus thermophilus [TaxId: 274]}
mrivpfgaarevtgsahlllaggrrvlldcgmfqgkeearnhapfgfdpkevdavlltha
hldhvgrlpklfregyrgpvyatratvllmeivledalkvmdepffgpedveealghlrp
leygewlrlgalslafgqaghlpgsafvvaqgegrtlvysgdlgnrekdvlpdpslppla
dlvlaegtygdrphrpyretvrefleilektlsqggkvliptfaveraqeilyvlythgh
rlprapiyldspmagrvlslyprlvryfseevqahflqgknpfrpaglevvehteaskal
nrapgpmvvlagsgmlaggrilhhlkhglsdprnalvfvgyqpqgglgaeiiarppavri
lgeevplrasvhtlggfsghagqdelldwlqgeprvvlvhgeeekllalgkllalrgqev
slarfgegvpv

SCOPe Domain Coordinates for d2dkfa1:

Click to download the PDB-style file with coordinates for d2dkfa1.
(The format of our PDB-style files is described here.)

Timeline for d2dkfa1: