Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.0: automated matches [191350] (1 protein) not a true family |
Protein automated matches [190292] (10 species) not a true protein |
Species Vibrio cholerae [TaxId:666] [189015] (2 PDB entries) |
Domain d3iebd_: 3ieb D: [178269] automated match to d1kv8a_ complexed with gol, so4 |
PDB Entry: 3ieb (more details), 2.1 Å
SCOPe Domain Sequences for d3iebd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iebd_ c.1.2.0 (D:) automated matches {Vibrio cholerae [TaxId: 666]} kpmiqialdqtnltdavavasnvasyvdvievgtilafaegmkavstlrhnhpnhilvcd mkttdggailsrmafeagadwitvsaaahiatiaackkvadelngeiqieiygnwtmqda kawvdlgitqaiyhrsrdaelagigwttddldkmrqlsalgielsitggivpediylfeg iktktfiagralagaegqqtaaalreqidrfwp
Timeline for d3iebd_:
View in 3D Domains from other chains: (mouse over for more information) d3ieba_, d3iebb_, d3iebc_, d3iebe_ |