SCOPe 2.02: Domain d3iebb_: 3ieb B:

Lineage for d3iebb_ (3ieb B:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.0: automated matches [191350] (1 protein)
   not a true family

6. Protein automated matches [190292] (10 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [189015] (2 PDB entries)

8. Domain d3iebb_: 3ieb B: [178267]
   automated match to d1kv8a_
   complexed with gol, so4

Details for d3iebb_

PDB Entry: 3ieb, 2.1 Å

PDB Description: Crystal structure of 3-keto-L-gulonate-6-phosphate decarboxylase from Vibrio cholerae O1 biovar El Tor str. N16961

PDB Compounds: (B:) Hexulose-6-phosphate synthase SgbH

SCOPe Domain Sequences for d3iebb_:

Sequence; same for both SEQRES and ATOM records:

>d3iebb_ c.1.2.0 (B:) automated matches {Vibrio cholerae [TaxId: 666]}
tkpmiqialdqtnltdavavasnvasyvdvievgtilafaegmkavstlrhnhpnhilvc
dmkttdggailsrmafeagadwitvsaaahiatiaackkvadelngeiqieiygnwtmqd
akawvdlgitqaiyhrsrdaelagigwttddldkmrqlsalgielsitggivpediylfe
giktktfiagralagaegqqtaaalreqidrfwp

Timeline for d3iebb_:

• d3iebb_ first appeared in SCOPe 2.01
  
• d3iebb_ appears in SCOPe 2.03
  
• d3iebb_ appears in the current release, SCOPe 2.08