Class a: All alpha proteins [46456] (286 folds) |
Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily) 4 helices; folded leaf; right-handed superhelix |
Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) can be classified as disulfide-rich |
Family a.52.1.2: Proteinase/alpha-amylase inhibitors [47708] (3 proteins) |
Protein Trypsin/alpha-amylase inhibitor RBI [47711] (1 species) |
Species Eleusine coracana, seeds [TaxId:4511] [47712] (3 PDB entries) |
Domain d1b1ua_: 1b1u A: [17823] |
PDB Entry: 1b1u (more details), 2.2 Å
SCOPe Domain Sequences for d1b1ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b1ua_ a.52.1.2 (A:) Trypsin/alpha-amylase inhibitor RBI {Eleusine coracana, seeds [TaxId: 4511]} gtscipgmaiphnpldscrwyvstrtcgvgprlatqemkarccrqleaipaycrceavri lmdgvvtpsgqhegrllqdlpgcprqvqrafapklvtevecnlatihggpfclsllg
Timeline for d1b1ua_: