SCOPe 2.05: Domain d1b1ua_: 1b1u A:

Lineage for d1b1ua_ (1b1u A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
   4 helices; folded leaf; right-handed superhelix

4. Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families)
   can be classified as disulfide-rich

5. Family a.52.1.2: Proteinase/alpha-amylase inhibitors [47708] (3 proteins)

6. Protein Trypsin/alpha-amylase inhibitor RBI [47711] (1 species)

7. Species Eleusine coracana, seeds [TaxId:4511] [47712] (3 PDB entries)

8. Domain d1b1ua_: 1b1u A: [17823]

Details for d1b1ua_

PDB Entry: 1b1u, 2.2 Å

PDB Description: crystal structure of the bifunctional inhibitor ragi

PDB Compounds: (A:) protein (alpha-amylase/trypsin inhibitor rati)

SCOPe Domain Sequences for d1b1ua_:

Sequence; same for both SEQRES and ATOM records:

>d1b1ua_ a.52.1.2 (A:) Trypsin/alpha-amylase inhibitor RBI {Eleusine coracana, seeds [TaxId: 4511]}
gtscipgmaiphnpldscrwyvstrtcgvgprlatqemkarccrqleaipaycrceavri
lmdgvvtpsgqhegrllqdlpgcprqvqrafapklvtevecnlatihggpfclsllg

Timeline for d1b1ua_:

• d1b1ua_ first appeared (with stable ids) in SCOP 1.55
  
• d1b1ua_ appears in SCOPe 2.04
  
• d1b1ua_ appears in SCOPe 2.06
  
• d1b1ua_ appears in the current release, SCOPe 2.08