PDB entry 1b1u

View 1b1u on RCSB PDB site
Description: crystal structure of the bifunctional inhibitor ragi
Class: hydrolase inhibitor
Keywords: alpha-amylase/trypsin inhibitor (rati), bifunctional, hydrolase inhibitor
Deposited on 1998-11-23, released 1998-12-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.222
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (alpha-amylase/trypsin inhibitor rati)
    Species: Eleusine coracana [TaxId:4511]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1b1ua_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b1uA (A:)
    svgtscipgmaiphnpldscrwyvstrtcgvgprlatqemkarccrqleaipaycrceav
    rilmdgvvtpsgqhegrllqdlpgcprqvqrafapklvtevecnlatihggpfclsllga
    ge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b1uA (A:)
    gtscipgmaiphnpldscrwyvstrtcgvgprlatqemkarccrqleaipaycrceavri
    lmdgvvtpsgqhegrllqdlpgcprqvqrafapklvtevecnlatihggpfclsllg