Lineage for d1b1ua_ (1b1u A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714860Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
    4 helices; folded leaf; right-handed superhelix
  4. 2714861Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) (S)
    can be classified as disulfide-rich
  5. 2714923Family a.52.1.2: Proteinase/alpha-amylase inhibitors [47708] (3 proteins)
  6. 2714934Protein Trypsin/alpha-amylase inhibitor RBI [47711] (1 species)
  7. 2714935Species Eleusine coracana, seeds [TaxId:4511] [47712] (3 PDB entries)
  8. 2714936Domain d1b1ua_: 1b1u A: [17823]

Details for d1b1ua_

PDB Entry: 1b1u (more details), 2.2 Å

PDB Description: crystal structure of the bifunctional inhibitor ragi
PDB Compounds: (A:) protein (alpha-amylase/trypsin inhibitor rati)

SCOPe Domain Sequences for d1b1ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b1ua_ a.52.1.2 (A:) Trypsin/alpha-amylase inhibitor RBI {Eleusine coracana, seeds [TaxId: 4511]}
gtscipgmaiphnpldscrwyvstrtcgvgprlatqemkarccrqleaipaycrceavri
lmdgvvtpsgqhegrllqdlpgcprqvqrafapklvtevecnlatihggpfclsllg

SCOPe Domain Coordinates for d1b1ua_:

Click to download the PDB-style file with coordinates for d1b1ua_.
(The format of our PDB-style files is described here.)

Timeline for d1b1ua_: