SCOPe 2.08: Domain d3hpwa_: 3hpw A:

Lineage for d3hpwa_ (3hpw A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families)
   contains insert beta-sheet subdomain and C-terminal helix

5. Family b.34.6.1: CcdB [50119] (1 protein)
   automatically mapped to Pfam PF01845

6. Protein CcdB [50120] (2 species)
   topoisomerase poison

7. Species Escherichia coli [TaxId:562] [50121] (7 PDB entries)

8. Domain d3hpwa_: 3hpw A: [177768]
   automated match to d1vuba_
   complexed with peg, so4

Details for d3hpwa_

PDB Entry: 3hpw, 1.45 Å

PDB Description: CcdB dimer in complex with one C-terminal CcdA domain

PDB Compounds: (A:) Cytotoxic protein ccdB

SCOPe Domain Sequences for d3hpwa_:

Sequence; same for both SEQRES and ATOM records:

>d3hpwa_ b.34.6.1 (A:) CcdB {Escherichia coli [TaxId: 562]}
mqfkvytykresryrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdes
wrmmttdmasvpvsvigeevadlshrendiknainlmfwgi

Timeline for d3hpwa_:

• d3hpwa_ first appeared in SCOPe 2.01
  
• d3hpwa_ appears in SCOPe 2.07