Lineage for d3hpwb_ (3hpw B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784275Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families) (S)
    contains insert beta-sheet subdomain and C-terminal helix
  5. 2784276Family b.34.6.1: CcdB [50119] (1 protein)
    automatically mapped to Pfam PF01845
  6. 2784277Protein CcdB [50120] (2 species)
    topoisomerase poison
  7. 2784278Species Escherichia coli [TaxId:562] [50121] (7 PDB entries)
  8. 2784280Domain d3hpwb_: 3hpw B: [177769]
    automated match to d1vuba_
    complexed with peg, so4

Details for d3hpwb_

PDB Entry: 3hpw (more details), 1.45 Å

PDB Description: CcdB dimer in complex with one C-terminal CcdA domain
PDB Compounds: (B:) Cytotoxic protein ccdB

SCOPe Domain Sequences for d3hpwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hpwb_ b.34.6.1 (B:) CcdB {Escherichia coli [TaxId: 562]}
mqfkvytykresryrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdes
wrmmttdmasvpvsvigeevadlshrendiknainlmfwgi

SCOPe Domain Coordinates for d3hpwb_:

Click to download the PDB-style file with coordinates for d3hpwb_.
(The format of our PDB-style files is described here.)

Timeline for d3hpwb_: