![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families) ![]() contains insert beta-sheet subdomain and C-terminal helix |
![]() | Family b.34.6.1: CcdB [50119] (1 protein) automatically mapped to Pfam PF01845 |
![]() | Protein CcdB [50120] (2 species) topoisomerase poison |
![]() | Species Escherichia coli [TaxId:562] [50121] (7 PDB entries) |
![]() | Domain d1vuba_: 1vub A: [24623] complexed with cl |
PDB Entry: 1vub (more details), 2.6 Å
SCOPe Domain Sequences for d1vuba_:
Sequence, based on SEQRES records: (download)
>d1vuba_ b.34.6.1 (A:) CcdB {Escherichia coli [TaxId: 562]} mqfkvytykresryrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdes wrmmttdmasvpvsvigeevadlshrendiknainlmfwgi
>d1vuba_ b.34.6.1 (A:) CcdB {Escherichia coli [TaxId: 562]} mqfkvytyrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdeswrmmtt dmasvpvsvigeevadlshrendiknainlmfwgi
Timeline for d1vuba_: