PDB entry 3hpw

View 3hpw on RCSB PDB site
Description: CcdB dimer in complex with one C-terminal CcdA domain
Class: toxin/toxin repressor
Keywords: ALPHA+BETA, SH3 domain, intrinsically disordered, TOXIN/TOXIN REPRESSOR COMPLEX
Deposited on 2009-06-05, released 2009-08-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-08-11, with a file datestamp of 2009-08-07.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.167
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cytotoxic protein ccdB
  Species: Escherichia coli [TaxId:562]
  Gene: ccdB, ECOK12F043, G, letB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62554 (0-100)
  Domains in SCOPe 2.08: d3hpwa_
• Chain 'B':
  Compound: Cytotoxic protein ccdB
  Species: Escherichia coli [TaxId:562]
  Gene: ccdB, ECOK12F043, G, letB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62554 (0-100)
  Domains in SCOPe 2.08: d3hpwb_
• Chain 'C':
  Compound: Protein ccdA
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62552 (Start-35)
• Heterogens: PEG, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3hpwA (A:)
  mqfkvytykresryrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdes
  wrmmttdmasvpvsvigeevadlshrendiknainlmfwgi
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3hpwB (B:)
  mqfkvytykresryrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdes
  wrmmttdmasvpvsvigeevadlshrendiknainlmfwgi
  

  
  
• Chain 'C':
  No sequence available.