PDB entry 3hpw
View 3hpw on RCSB PDB site
Description: CcdB dimer in complex with one C-terminal CcdA domain
Class: toxin/toxin repressor
Keywords: ALPHA+BETA, SH3 domain, intrinsically disordered, TOXIN/TOXIN REPRESSOR COMPLEX
Deposited on
2009-06-05, released
2009-08-11
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-08-11, with a file datestamp of
2009-08-07.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.167
AEROSPACI score: 0.67
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Cytotoxic protein ccdB
Species: Escherichia coli [TaxId:562]
Gene: ccdB, ECOK12F043, G, letB
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3hpwa_ - Chain 'B':
Compound: Cytotoxic protein ccdB
Species: Escherichia coli [TaxId:562]
Gene: ccdB, ECOK12F043, G, letB
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3hpwb_ - Chain 'C':
Compound: Protein ccdA
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: PEG, SO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3hpwA (A:)
mqfkvytykresryrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdes
wrmmttdmasvpvsvigeevadlshrendiknainlmfwgi
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3hpwB (B:)
mqfkvytykresryrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdes
wrmmttdmasvpvsvigeevadlshrendiknainlmfwgi
- Chain 'C':
No sequence available.