SCOPe 2.05: Domain d3hhwo_: 3hhw O:

Lineage for d3hhwo_ (3hhw O:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.260: Rhabdovirus nucleoprotein-like [140808] (1 superfamily)
   multihelical, consist of two helical domains; each domain contains a buried helix

4. Superfamily a.260.1: Rhabdovirus nucleoprotein-like [140809] (1 family)
   automatically mapped to Pfam PF00945

5. Family a.260.1.1: Rhabdovirus nucleocapsid protein [140810] (2 proteins)
   Pfam PF00945; RNA-binding homooligomeric protein

6. Protein automated matches [191075] (1 species)
   not a true protein

7. Species Vesicular stomatitis indiana virus [TaxId:11277] [188986] (1 PDB entry)

8. Domain d3hhwo_: 3hhw O: [177591]
   automated match to d2gica1
   protein/RNA complex; complexed with tar

Details for d3hhwo_

PDB Entry: 3hhw, 2.7 Å

PDB Description: complex of a vesicular stomatitis virus empty capsid with the nucleocapsid-binding domain of the phosphoprotein

PDB Compounds: (O:) nucleoprotein

SCOPe Domain Sequences for d3hhwo_:

Sequence; same for both SEQRES and ATOM records:

>d3hhwo_ a.260.1.1 (O:) automated matches {Vesicular stomatitis indiana virus [TaxId: 11277]}
svtvkriidntvivpklpanedpveypadyfrkskeiplyinttkslsdlrgyvyqglks
gnvsiihvnsylygalkdirgkldkdwssfginigkagdtigifdlvslkaldgvlpdgv
sdasrtsaddkwlplyllglyrvgrtqmpeyrkklmdgltnqckmineqfeplvpegrdi
fdvwgndsnytkivaavdmffhmfkkhecasfrygtivsrfkdcaalatfghlckitgms
tedvttwilnrevademvqmmlpgqeidkadsympylidfglsskspywsvknpafhfwg
qltalllrstrarnarqpddieytslttagllyayavgssadlaqqfcvgdnkytpddst
gglttnappqgrdvvewlgwfedqnrkptpdmmqyakravmslqglrektigkyaksefd
k

Timeline for d3hhwo_:

• d3hhwo_ first appeared in SCOPe 2.01
  
• d3hhwo_ appears in SCOPe 2.04
  
• d3hhwo_ appears in SCOPe 2.06
  
• d3hhwo_ appears in the current release, SCOPe 2.08