Class a: All alpha proteins [46456] (286 folds) |
Fold a.260: Rhabdovirus nucleoprotein-like [140808] (1 superfamily) multihelical, consist of two helical domains; each domain contains a buried helix |
Superfamily a.260.1: Rhabdovirus nucleoprotein-like [140809] (1 family) automatically mapped to Pfam PF00945 |
Family a.260.1.1: Rhabdovirus nucleocapsid protein [140810] (2 proteins) Pfam PF00945; RNA-binding homooligomeric protein |
Protein automated matches [191075] (1 species) not a true protein |
Species Vesicular stomatitis indiana virus [TaxId:11277] [188986] (1 PDB entry) |
Domain d3hhwn_: 3hhw N: [177590] automated match to d2gica1 protein/RNA complex; complexed with tar |
PDB Entry: 3hhw (more details), 2.7 Å
SCOPe Domain Sequences for d3hhwn_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hhwn_ a.260.1.1 (N:) automated matches {Vesicular stomatitis indiana virus [TaxId: 11277]} svtvkriidntvivpklpanedpveypadyfrkskeiplyinttkslsdlrgyvyqglks gnvsiihvnsylygalkdirgkldkdwssfginigkagdtigifdlvslkaldgvlpdgv sdasrtsaddkwlplyllglyrvgrtqmpeyrkklmdgltnqckmineqfeplvpegrdi fdvwgndsnytkivaavdmffhmfkkhecasfrygtivsrfkdcaalatfghlckitgms tedvttwilnrevademvqmmlpgqeidkadsympylidfglsskspywsvknpafhfwg qltalllrstrarnarqpddieytslttagllyayavgssadlaqqfcvgdnkytpddst gglttnappqgrdvvewlgwfedqnrkptpdmmqyakravmslqglrektigkyaksefd k
Timeline for d3hhwn_:
View in 3D Domains from other chains: (mouse over for more information) d3hhwk_, d3hhwl_, d3hhwm_, d3hhwo_ |