Lineage for d3hhwo_ (3hhw O:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738416Fold a.260: Rhabdovirus nucleoprotein-like [140808] (1 superfamily)
    multihelical, consist of two helical domains; each domain contains a buried helix
  4. 2738417Superfamily a.260.1: Rhabdovirus nucleoprotein-like [140809] (1 family) (S)
    automatically mapped to Pfam PF00945
  5. 2738418Family a.260.1.1: Rhabdovirus nucleocapsid protein [140810] (2 proteins)
    Pfam PF00945; RNA-binding homooligomeric protein
  6. 2738464Protein automated matches [191075] (1 species)
    not a true protein
  7. 2738465Species Vesicular stomatitis indiana virus [TaxId:11277] [188986] (1 PDB entry)
  8. 2738470Domain d3hhwo_: 3hhw O: [177591]
    automated match to d2gica1
    protein/RNA complex; complexed with tar

Details for d3hhwo_

PDB Entry: 3hhw (more details), 2.7 Å

PDB Description: complex of a vesicular stomatitis virus empty capsid with the nucleocapsid-binding domain of the phosphoprotein
PDB Compounds: (O:) nucleoprotein

SCOPe Domain Sequences for d3hhwo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hhwo_ a.260.1.1 (O:) automated matches {Vesicular stomatitis indiana virus [TaxId: 11277]}
svtvkriidntvivpklpanedpveypadyfrkskeiplyinttkslsdlrgyvyqglks
gnvsiihvnsylygalkdirgkldkdwssfginigkagdtigifdlvslkaldgvlpdgv
sdasrtsaddkwlplyllglyrvgrtqmpeyrkklmdgltnqckmineqfeplvpegrdi
fdvwgndsnytkivaavdmffhmfkkhecasfrygtivsrfkdcaalatfghlckitgms
tedvttwilnrevademvqmmlpgqeidkadsympylidfglsskspywsvknpafhfwg
qltalllrstrarnarqpddieytslttagllyayavgssadlaqqfcvgdnkytpddst
gglttnappqgrdvvewlgwfedqnrkptpdmmqyakravmslqglrektigkyaksefd
k

SCOPe Domain Coordinates for d3hhwo_:

Click to download the PDB-style file with coordinates for d3hhwo_.
(The format of our PDB-style files is described here.)

Timeline for d3hhwo_: