SCOP 1.59: Domain d1g6wd1: 1g6w D:201-354

Lineage for d1g6wd1 (1g6w D:201-354)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)

4. Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family)

5. Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)

6. Protein Yeast prion protein ure2p, nitrogen regulation fragment [47641] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47642] (8 PDB entries)

8. Domain d1g6wd1: 1g6w D:201-354 [17754]
   Other proteins in same PDB: d1g6wa2, d1g6wb2, d1g6wc2, d1g6wd2

Details for d1g6wd1

PDB Entry: 1g6w, 2.5 Å

PDB Description: crystal structure of the globular region of the prion protein ure2 from the yeast saccaromyces cerevisiae

SCOP Domain Sequences for d1g6wd1:

Sequence; same for both SEQRES and ATOM records:

>d1g6wd1 a.45.1.1 (D:201-354) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae)}
lwsddladqsqinawlffqtsghapmigqalhfryfhsqkiasaverytdevrrvygvve
malaerrealvmeldtenaaaysagttpmsqsrffdypvwlvgdkltiadlafvpwnnvv
driginikiefpevykwtkhmmrrpavikalrge

Timeline for d1g6wd1:

• d1g6wd1 first appeared (with stable ids) in SCOP 1.55
  
• d1g6wd1 appears in SCOP 1.57
  
• d1g6wd1 appears in SCOP 1.61
  
• d1g6wd1 appears in the current release, SCOPe 2.08