Lineage for d1g6wd1 (1g6w D:201-354)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 97949Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 97950Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 97951Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 98224Protein Yeast prion protein ure2p, nitrogen regulation fragment [47641] (1 species)
  7. 98225Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47642] (8 PDB entries)
  8. 98239Domain d1g6wd1: 1g6w D:201-354 [17754]
    Other proteins in same PDB: d1g6wa2, d1g6wb2, d1g6wc2, d1g6wd2

Details for d1g6wd1

PDB Entry: 1g6w (more details), 2.5 Å

PDB Description: crystal structure of the globular region of the prion protein ure2 from the yeast saccaromyces cerevisiae

SCOP Domain Sequences for d1g6wd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g6wd1 a.45.1.1 (D:201-354) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae)}
lwsddladqsqinawlffqtsghapmigqalhfryfhsqkiasaverytdevrrvygvve
malaerrealvmeldtenaaaysagttpmsqsrffdypvwlvgdkltiadlafvpwnnvv
driginikiefpevykwtkhmmrrpavikalrge

SCOP Domain Coordinates for d1g6wd1:

Click to download the PDB-style file with coordinates for d1g6wd1.
(The format of our PDB-style files is described here.)

Timeline for d1g6wd1: