| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
| Protein Yeast prion protein ure2p, nitrogen regulation fragment [47641] (1 species) similar to class phi enzymes |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47642] (8 PDB entries) |
| Domain d1g6wd1: 1g6w D:201-354 [17754] Other proteins in same PDB: d1g6wa2, d1g6wb2, d1g6wc2, d1g6wd2 |
PDB Entry: 1g6w (more details), 2.5 Å
SCOPe Domain Sequences for d1g6wd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g6wd1 a.45.1.1 (D:201-354) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lwsddladqsqinawlffqtsghapmigqalhfryfhsqkiasaverytdevrrvygvve
malaerrealvmeldtenaaaysagttpmsqsrffdypvwlvgdkltiadlafvpwnnvv
driginikiefpevykwtkhmmrrpavikalrge
Timeline for d1g6wd1: