| Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) |
Superfamily c.47.1: Thioredoxin-like [52833] (12 families) ![]() |
| Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins) |
| Protein Yeast prion protein ure2p, nitrogen regulation fragment [52886] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52887] (8 PDB entries) |
| Domain d1g6wa2: 1g6w A:100-200 [33045] Other proteins in same PDB: d1g6wa1, d1g6wb1, d1g6wc1, d1g6wd1 |
PDB Entry: 1g6w (more details), 2.5 Å
SCOP Domain Sequences for d1g6wa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g6wa2 c.47.1.5 (A:100-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae)}
sritkffqeqplegytlfshrsapngfkvaivlselgfhyntifldfnlgehrapefvsv
npnarvpalidhgmdnlsiwesgaillhlvnkyyketgnpl
Timeline for d1g6wa2: