| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins) |
| Protein Class phi GST [81356] (3 species) |
| Species Maize (Zea mays), type I [TaxId:4577] [47636] (2 PDB entries) |
| Domain d1byed1: 1bye D:81-213 [17735] Other proteins in same PDB: d1byea2, d1byeb2, d1byec2, d1byed2 complexed with ata |
PDB Entry: 1bye (more details), 2.8 Å
SCOPe Domain Sequences for d1byed1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1byed1 a.45.1.1 (D:81-213) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]}
ellregnleeaamvdvwieveanqytaalnpilfqvlispmlggttdqkvvdenleklkk
vlevyearltkckylagdflsladlnhvsvtlclfatpyasvldayphvkawwsglmerp
svqkvaalmkpsa
Timeline for d1byed1: