SCOPe 2.01: Domain d1byea2: 1bye A:1-80

Lineage for d1byea2 (1bye A:1-80)

Root: SCOPe 2.01
Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
Superfamily c.47.1: Thioredoxin-like [52833] (24 families)
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
Protein Class phi GST [81367] (3 species)
Species Maize (Zea mays), type I [TaxId:4577] [52881] (2 PDB entries)
Domain d1byea2: 1bye A:1-80 [33026]
Other proteins in same PDB: d1byea1, d1byeb1, d1byec1, d1byed1
complexed with ata

Details for d1byea2

PDB Entry: 1bye (more details), 2.8 Å

PDB Description: glutathione s-transferase i from mais in complex with atrazine glutathione conjugate

PDB Compounds: (A:) protein (glutathione s-transferase)

SCOPe Domain Sequences for d1byea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1byea2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]}
apmklygavmswnltrcataleeagsdyeivpinfataehkspehlvrnpfgqvpalqdg
dlylfesraickyaarknkp

SCOPe Domain Coordinates for d1byea2:

Click to download the PDB-style file with coordinates for d1byea2.
(The format of our PDB-style files is described here.)

Timeline for d1byea2: