![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
![]() | Protein Class sigma GST [81351] (5 species) |
![]() | Species Squid (Ommastrephes sloani pacificus) [TaxId:6634] [47631] (2 PDB entries) |
![]() | Domain d1gsqa1: 1gsq A:76-202 [17716] Other proteins in same PDB: d1gsqa2 complexed with gdn |
PDB Entry: 1gsq (more details), 2.4 Å
SCOPe Domain Sequences for d1gsqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} ldgktslekyrvdeitetlqdifndvvkikfapeaakeavqqnyeksckrlapflegllv sngggdgffvgnsmtladlhcyvalevplkhtpellkdcpkivalrkrvaecpkiaaylk krpvrdf
Timeline for d1gsqa1: