![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins) Pfam PF00866 |
![]() | Protein automated matches [190223] (5 species) not a true protein |
![]() | Species Comamonas testosteroni [TaxId:285] [189310] (2 PDB entries) |
![]() | Domain d3gzyb_: 3gzy B: [177119] Other proteins in same PDB: d3gzya1, d3gzya2 automated match to d1wqlb1 complexed with fe2, fes, mes |
PDB Entry: 3gzy (more details), 1.62 Å
SCOPe Domain Sequences for d3gzyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gzyb_ d.17.4.4 (B:) automated matches {Comamonas testosteroni [TaxId: 285]} mistplskefewpakpvslelqhqveqfyyreaqlldhhafqawfallaedihywmpirt vrtareqgleyvpaganahfddthatmygrirqktsdlnwaedppsrtrhlvsnvivrem dtpgtlevasafllyrsrlerqvdvfagerrdvlriadnplgfqiakrtiildqstvlan nlsvff
Timeline for d3gzyb_: