| Class b: All beta proteins [48724] (177 folds) |
| Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) ![]() |
| Family b.33.1.0: automated matches [191455] (1 protein) not a true family |
| Protein automated matches [190701] (11 species) not a true protein |
| Species Comamonas testosteroni [TaxId:285] [232352] (2 PDB entries) |
| Domain d3gzya1: 3gzy A:18-178 [239331] Other proteins in same PDB: d3gzya2, d3gzyb_ automated match to d3gzxa1 complexed with fe2, fes, mes |
PDB Entry: 3gzy (more details), 1.62 Å
SCOPe Domain Sequences for d3gzya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gzya1 b.33.1.0 (A:18-178) automated matches {Comamonas testosteroni [TaxId: 285]}
nwtpdairalvdqdngkldariyadqdlyqlelervfgrswlmlghethipkigdyltty
mgedpvimvrqkdqsikvflnqcrhrgmrivrsdggnakaftctyhgwaydiagnlvnvp
fekeafcdkkegdcgfdkadwgplqarvetykglvfanwdp
Timeline for d3gzya1: