Lineage for d3gr6j1 (3gr6 J:1-256)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842037Protein Enoyl-ACP reductase [51791] (11 species)
  7. 2842402Species Staphylococcus aureus [TaxId:1280] [189086] (3 PDB entries)
  8. 2842406Domain d3gr6j1: 3gr6 J:1-256 [176928]
    Other proteins in same PDB: d3gr6d2, d3gr6j2
    automated match to d1ulua_
    complexed with nap, tcl

Details for d3gr6j1

PDB Entry: 3gr6 (more details), 2.28 Å

PDB Description: Crystal structure of the staphylococcus aureus enoyl-acyl carrier protein reductase (fabI) in complex with NADP and triclosan
PDB Compounds: (J:) Enoyl-[acyl-carrier-protein] reductase [NADH]

SCOPe Domain Sequences for d3gr6j1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gr6j1 c.2.1.2 (J:1-256) Enoyl-ACP reductase {Staphylococcus aureus [TaxId: 1280]}
mlnlenktyvimgiankrsiafgvakvldqlgaklvftyrkersrkeleklleqlnqpea
hlyqidvqsdeevingfeqigkdvgnidgvyhsiafanmedlrgrfsetsregfllaqdi
ssysltivaheakklmpeggsivattylggefavqnynvmgvakasleanvkylaldlgp
dnirvnaisagpirtlsakgvggfntilkeieeraplkrnvdqvevgktaayllsdlssg
vtgenihvdsgfhaik

SCOPe Domain Coordinates for d3gr6j1:

Click to download the PDB-style file with coordinates for d3gr6j1.
(The format of our PDB-style files is described here.)

Timeline for d3gr6j1: