| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
| Protein Enoyl-ACP reductase [51791] (11 species) |
| Species Staphylococcus aureus [TaxId:1280] [189086] (3 PDB entries) |
| Domain d3gr6g_: 3gr6 G: [176927] Other proteins in same PDB: d3gr6d2, d3gr6j2 automated match to d1ulua_ complexed with nap, tcl |
PDB Entry: 3gr6 (more details), 2.28 Å
SCOPe Domain Sequences for d3gr6g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gr6g_ c.2.1.2 (G:) Enoyl-ACP reductase {Staphylococcus aureus [TaxId: 1280]}
nlenktyvimgiankrsiafgvakvldqlgaklvftyrkersrkeleklleqlnqpeahl
yqidvqsdeevingfeqigkdvgnidgvyhsiafanmedlrgrfsetsregfllaqdiss
ysltivaheakklmpeggsivattylggefavqnynvmgvakasleanvkylaldlgpdn
irvnaisagpirtlsakgvggfntilkeieeraplkrnvdqvevgktaayllsdlssgvt
genihvdsgfhaik
Timeline for d3gr6g_: