Lineage for d1gsfb1 (1gsf B:81-222)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3694Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 3695Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 3696Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (2 proteins)
  6. 3697Protein Glutathione S-transferase [47618] (22 species)
  7. 3713Species Human (Homo sapiens), class alpha (a1-1) [TaxId:9606] [47625] (7 PDB entries)
  8. 3721Domain d1gsfb1: 1gsf B:81-222 [17674]
    Other proteins in same PDB: d1gsfa2, d1gsfb2

Details for d1gsfb1

PDB Entry: 1gsf (more details), 2.7 Å

PDB Description: glutathione transferase a1-1 complexed with ethacrynic acid

SCOP Domain Sequences for d1gsfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gsfb1 a.45.1.1 (B:81-222) Glutathione S-transferase {Human (Homo sapiens), class alpha (a1-1)}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleearkifrf

SCOP Domain Coordinates for d1gsfb1:

Click to download the PDB-style file with coordinates for d1gsfb1.
(The format of our PDB-style files is described here.)

Timeline for d1gsfb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gsfb2