Lineage for d3gj2a_ (3gj2 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2939774Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2939778Protein Green fluorescent protein, GFP [54513] (6 species)
  7. 2939786Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (285 PDB entries)
    Uniprot P42212
  8. 2940073Domain d3gj2a_: 3gj2 A: [176681]
    Other proteins in same PDB: d3gj2b2
    automated match to d1q4aa_
    complexed with cl

Details for d3gj2a_

PDB Entry: 3gj2 (more details), 1.9 Å

PDB Description: photoactivated state of pa-gfp
PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d3gj2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gj2a_ d.22.1.1 (A:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttfgygvqcfsrypdhmkrhdffksampegyvqertisfkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleynynshnvyitadkqkngikanfkirhniedgsvqladh
yqqntpigdgpvllpdnhylshqsalskdpnekrdhmvllefvtaagit

SCOPe Domain Coordinates for d3gj2a_:

Click to download the PDB-style file with coordinates for d3gj2a_.
(The format of our PDB-style files is described here.)

Timeline for d3gj2a_: