| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins) |
| Protein Class pi GST [81347] (4 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [47621] (9 PDB entries) |
| Domain d1glpb1: 1glp B:79-209 [17591] Other proteins in same PDB: d1glpa2, d1glpb2 complexed with gts |
PDB Entry: 1glp (more details), 1.9 Å
SCOPe Domain Sequences for d1glpb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1glpb1 a.45.1.1 (B:79-209) Class pi GST {Mouse (Mus musculus) [TaxId: 10090]}
ygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvkalpghlkpfetllsqnqg
gkafivgdqisfadynlldlllihqvlapgcldnfpllsayvarlsarpkikaflsspeh
vnrpingngkq
Timeline for d1glpb1: