Lineage for d1glpb1 (1glp B:79-209)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 769705Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 769706Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 769707Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 769985Protein Class pi GST [81347] (4 species)
  7. 770082Species Mouse (Mus musculus) [TaxId:10090] [47621] (9 PDB entries)
  8. 770086Domain d1glpb1: 1glp B:79-209 [17591]
    Other proteins in same PDB: d1glpa2, d1glpb2
    complexed with gts

Details for d1glpb1

PDB Entry: 1glp (more details), 1.9 Å

PDB Description: 1.8 angstroms molecular structure of mouse liver class pi glutathione s-transferase complexed with s-(p-nitrobenzyl)glutathione and other inhibitors
PDB Compounds: (B:) glutathione s-transferase yfyf

SCOP Domain Sequences for d1glpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1glpb1 a.45.1.1 (B:79-209) Class pi GST {Mouse (Mus musculus) [TaxId: 10090]}
ygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvkalpghlkpfetllsqnqg
gkafivgdqisfadynlldlllihqvlapgcldnfpllsayvarlsarpkikaflsspeh
vnrpingngkq

SCOP Domain Coordinates for d1glpb1:

Click to download the PDB-style file with coordinates for d1glpb1.
(The format of our PDB-style files is described here.)

Timeline for d1glpb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1glpb2