Lineage for d1eohf1 (1eoh F:77-209)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. Protein Class pi GST [81347] (4 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [47619] (66 PDB entries)
  8. Domain d1eohf1: 1eoh F:77-209 [17579]
    Other proteins in same PDB: d1eoha2, d1eohb2, d1eohc2, d1eohd2, d1eohe2, d1eohf2, d1eohg2, d1eohh2

Details for d1eohf1

PDB Entry: 1eoh (more details), 2.5 Å

PDB Description: glutathione transferase p1-1
PDB Compounds: (F:) glutathione s-transferase

SCOPe Domain Sequences for d1eohf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eohf1 a.45.1.1 (F:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfaaynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOPe Domain Coordinates for d1eohf1 are not available.

Timeline for d1eohf1:

Domains from same chain:
(mouse over for more information)
d1eohf2
Domains from other chains:
(mouse over for more information)
d1eoha1, d1eoha2, d1eohb1, d1eohb2, d1eohc1, d1eohc2, d1eohd1, d1eohd2, d1eohe1, d1eohe2, d1eohg1, d1eohg2, d1eohh1, d1eohh2