PDB entry 1eoh

View 1eoh on RCSB PDB site
Description: glutathione transferase p1-1
Class: transferase
Keywords: glutathione transferase, helix capping mutant (D152A)
Deposited on 2000-03-22, released 2000-10-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.231
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09211 (0-208)
      • engineered (151)
    Domains in SCOPe 2.08: d1eoha1, d1eoha2
  • Chain 'B':
    Compound: glutathione s-transferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09211 (0-208)
      • engineered (151)
    Domains in SCOPe 2.08: d1eohb1, d1eohb2
  • Chain 'C':
    Compound: glutathione s-transferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09211 (0-208)
      • engineered (151)
    Domains in SCOPe 2.08: d1eohc1, d1eohc2
  • Chain 'D':
    Compound: glutathione s-transferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09211 (0-208)
      • engineered (151)
    Domains in SCOPe 2.08: d1eohd1, d1eohd2
  • Chain 'E':
    Compound: glutathione s-transferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09211 (0-208)
      • engineered (151)
    Domains in SCOPe 2.08: d1eohe1, d1eohe2
  • Chain 'F':
    Compound: glutathione s-transferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09211 (0-208)
      • engineered (151)
    Domains in SCOPe 2.08: d1eohf1, d1eohf2
  • Chain 'G':
    Compound: glutathione s-transferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09211 (0-208)
      • engineered (151)
    Domains in SCOPe 2.08: d1eohg1, d1eohg2
  • Chain 'H':
    Compound: glutathione s-transferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09211 (0-208)
      • engineered (151)
    Domains in SCOPe 2.08: d1eohh1, d1eohh2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eohA (A:)
    ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
    tlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvk
    alpgqlkpfetllsqnqggktfivgdqisfaaynlldlllihevlapgcldafpllsayv
    grlsarpklkaflaspeyvnlpingngkq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eohB (B:)
    ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
    tlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvk
    alpgqlkpfetllsqnqggktfivgdqisfaaynlldlllihevlapgcldafpllsayv
    grlsarpklkaflaspeyvnlpingngkq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eohC (C:)
    ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
    tlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvk
    alpgqlkpfetllsqnqggktfivgdqisfaaynlldlllihevlapgcldafpllsayv
    grlsarpklkaflaspeyvnlpingngkq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eohD (D:)
    ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
    tlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvk
    alpgqlkpfetllsqnqggktfivgdqisfaaynlldlllihevlapgcldafpllsayv
    grlsarpklkaflaspeyvnlpingngkq
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eohE (E:)
    ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
    tlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvk
    alpgqlkpfetllsqnqggktfivgdqisfaaynlldlllihevlapgcldafpllsayv
    grlsarpklkaflaspeyvnlpingngkq
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eohF (F:)
    ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
    tlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvk
    alpgqlkpfetllsqnqggktfivgdqisfaaynlldlllihevlapgcldafpllsayv
    grlsarpklkaflaspeyvnlpingngkq
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eohG (G:)
    ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
    tlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvk
    alpgqlkpfetllsqnqggktfivgdqisfaaynlldlllihevlapgcldafpllsayv
    grlsarpklkaflaspeyvnlpingngkq
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eohH (H:)
    ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
    tlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvk
    alpgqlkpfetllsqnqggktfivgdqisfaaynlldlllihevlapgcldafpllsayv
    grlsarpklkaflaspeyvnlpingngkq