Lineage for d3fh9b_ (3fh9 B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 901830Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 903555Protein automated matches [190359] (30 species)
    not a true protein
  7. 903736Species Pteropus giganteus [TaxId:143291] [188768] (1 PDB entry)
  8. 903738Domain d3fh9b_: 3fh9 B: [175782]
    automated match to d1aj9b_
    complexed with hem, oxy

Details for d3fh9b_

PDB Entry: 3fh9 (more details), 1.62 Å

PDB Description: crystal structure determination of indian flying fox (pteropus giganteus) at 1.62 a resolution
PDB Compounds: (B:) hemoglobin beta chain

SCOPe Domain Sequences for d3fh9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fh9b_ a.1.1.2 (B:) automated matches {Pteropus giganteus [TaxId: 143291]}
vhlsgeekaavtglwgkvkvdevggealgrllvvypwtqrffdsfgdlssasavmgnpkv
kahgkkvldsfseglqhldnlkgtfaklselhcdklhvdpenfrllgnvlvcvlarhfgk
eftpqvqaayqkvvagvanalahkyh

SCOPe Domain Coordinates for d3fh9b_:

Click to download the PDB-style file with coordinates for d3fh9b_.
(The format of our PDB-style files is described here.)

Timeline for d3fh9b_: