SCOPe 2.08: Domain d3fdla1: 3fdl A:1-194

Lineage for d3fdla1 (3fdl A:1-194)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein automated matches [190236] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188722] (26 PDB entries)

8. Domain d3fdla1: 3fdl A:1-194 [175710]
   Other proteins in same PDB: d3fdla2
   automated match to d1g5ja_

Details for d3fdla1

PDB Entry: 3fdl, 1.78 Å

PDB Description: bim bh3 peptide in complex with bcl-xl

PDB Compounds: (A:) apoptosis regulator bcl-x

SCOPe Domain Sequences for d3fdla1:

Sequence; same for both SEQRES and ATOM records:

>d3fdla1 f.1.4.1 (A:1-194) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msqsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhitp
gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd
hlepwiqenggwdtfvel

Timeline for d3fdla1:

• d3fdla1 first appeared in SCOPe 2.01, called d3fdla_
  
• d3fdla1 appears in SCOPe 2.07