SCOPe 2.07: Domain d3fbwa1: 3fbw A:3-293

Lineage for d3fbwa1 (3fbw A:3-293)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins)

6. Protein automated matches [190880] (5 species)
   not a true protein

7. Species Rhodococcus rhodochrous [TaxId:1829] [189127] (16 PDB entries)

8. Domain d3fbwa1: 3fbw A:3-293 [175665]
   Other proteins in same PDB: d3fbwa2
   automated match to d1bn6a_
   complexed with bez, cl, mg; mutant

Details for d3fbwa1

PDB Entry: 3fbw, 1.23 Å

PDB Description: structure of rhodococcus rhodochrous haloalkane dehalogenase dhaa mutant c176y

PDB Compounds: (A:) haloalkane dehalogenase

SCOPe Domain Sequences for d3fbwa1:

Sequence; same for both SEQRES and ATOM records:

>d3fbwa1 c.69.1.8 (A:3-293) automated matches {Rhodococcus rhodochrous [TaxId: 1829]}
eigtgfpfdphyvevlgermhyvdvgprdgtpvlflhgnptssylwrniiphvapshrci
apdligmgksdkpdldyffddhvryldafiealgleevvlvihdwgsalgfhwakrnper
vkgiacmefirpiptwdewpefaretfqafrtadvgreliidqnafiegalpkyvvrplt
evemdhyrepflkpvdreplwrfpnelpiagepanivalveaymnwlhqspvpkllfwgt
pgvlippaeaarlaeslpncktvdigpglhylqednpdligseiarwlpal

Timeline for d3fbwa1:

• d3fbwa1 first appeared in SCOPe 2.01, called d3fbwa_
  
• d3fbwa1 appears in SCOPe 2.06
  
• d3fbwa1 appears in the current release, SCOPe 2.08