Lineage for d3f55c_ (3f55 C:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 969862Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 970330Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 970857Protein automated matches [190057] (11 species)
    not a true protein
  7. 970884Species Rubber tree (Hevea brasiliensis) [TaxId:3981] [189057] (2 PDB entries)
  8. 970891Domain d3f55c_: 3f55 C: [175475]
    automated match to d2cyga1
    complexed with cac, flc, nag

Details for d3f55c_

PDB Entry: 3f55 (more details), 2.8 Å

PDB Description: Crystal structure of the native endo beta-1,3-glucanase (Hev b 2), A major allergen from hevea brasiliensis (space group P41)
PDB Compounds: (C:) Beta-1,3-glucanase

SCOPe Domain Sequences for d3f55c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f55c_ c.1.8.3 (C:) automated matches {Rubber tree (Hevea brasiliensis) [TaxId: 3981]}
evgvcygmqgnnlppvsevialykksnitrmriydpnqavlealrgsnielilgvpnsdl
qsltnpsnakswvqknvrgfwssvrfryiavgneispvnrgtawlaqfvlpamrnihdai
rsaglqdqikvstaidltlvgnsyppsagafrddvrsylnpiirflssirspllaniypy
ftyagnprdislpyalftspsvvvwdgqrgyknlfdatldalysalerasggslevvvse
sgwpsagafaatfdngrtylsnliqhvkrgtpkrpkraietylfamfdenkkqpevekhf
glffpnkwqkynlnfs

SCOPe Domain Coordinates for d3f55c_:

Click to download the PDB-style file with coordinates for d3f55c_.
(The format of our PDB-style files is described here.)

Timeline for d3f55c_: