Lineage for d3f05a_ (3f05 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1775883Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1775884Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 1776026Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 1776050Protein Synaptogamin I [49576] (2 species)
    duplication: contains tandem repeat of two similar domains
  7. 1776051Species Human (Homo sapiens) [TaxId:9606] [158946] (10 PDB entries)
  8. 1776054Domain d3f05a_: 3f05 A: [175372]
    automated match to d1byna_
    complexed with mn, so4

Details for d3f05a_

PDB Entry: 3f05 (more details), 1.4 Å

PDB Description: crystal structure of synaptotagmin i c2a domain with mn(ii)
PDB Compounds: (A:) Synaptotagmin-1

SCOPe Domain Sequences for d3f05a_:

Sequence, based on SEQRES records: (download)

>d3f05a_ b.7.1.2 (A:) Synaptogamin I {Human (Homo sapiens) [TaxId: 9606]}
ggggildsmveklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdk
kkkfetkvhrktlnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmnt
vdfghvteewrdlqsa

Sequence, based on observed residues (ATOM records): (download)

>d3f05a_ b.7.1.2 (A:) Synaptogamin I {Human (Homo sapiens) [TaxId: 9606]}
ggggildsmveklgklqysldydfqnnqllvgiiqaaelpaldgtsdpyvkvfllpdkkk
kfetkvhrktlnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmntvd
fghvteewrdlqsa

SCOPe Domain Coordinates for d3f05a_:

Click to download the PDB-style file with coordinates for d3f05a_.
(The format of our PDB-style files is described here.)

Timeline for d3f05a_: