Lineage for d3f05a1 (3f05 A:140-265)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2772795Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) (S)
    two constituent families are related by circular permutation
  5. 2772956Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 2772982Protein Synaptogamin I [49576] (3 species)
    duplication: contains tandem repeat of two similar domains
  7. 2772983Species Human (Homo sapiens) [TaxId:9606] [158946] (14 PDB entries)
  8. 2772989Domain d3f05a1: 3f05 A:140-265 [175372]
    Other proteins in same PDB: d3f05a2
    automated match to d1byna_
    complexed with mn, so4

Details for d3f05a1

PDB Entry: 3f05 (more details), 1.4 Å

PDB Description: crystal structure of synaptotagmin i c2a domain with mn(ii)
PDB Compounds: (A:) Synaptotagmin-1

SCOPe Domain Sequences for d3f05a1:

Sequence, based on SEQRES records: (download)

>d3f05a1 b.7.1.2 (A:140-265) Synaptogamin I {Human (Homo sapiens) [TaxId: 9606]}
eklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkkkkfetkvhr
ktlnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmntvdfghvteew
rdlqsa

Sequence, based on observed residues (ATOM records): (download)

>d3f05a1 b.7.1.2 (A:140-265) Synaptogamin I {Human (Homo sapiens) [TaxId: 9606]}
eklgklqysldydfqnnqllvgiiqaaelpaldgtsdpyvkvfllpdkkkkfetkvhrkt
lnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmntvdfghvteewrd
lqsa

SCOPe Domain Coordinates for d3f05a1:

Click to download the PDB-style file with coordinates for d3f05a1.
(The format of our PDB-style files is described here.)

Timeline for d3f05a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3f05a2