| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins) |
| Protein Class pi GST [81347] (4 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47619] (41 PDB entries) |
| Domain d6gssa1: 6gss A:77-209 [17534] Other proteins in same PDB: d6gssa2, d6gssb2 complexed with gsh, mes |
PDB Entry: 6gss (more details), 1.9 Å
SCOPe Domain Sequences for d6gssa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gssa1 a.45.1.1 (A:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq
Timeline for d6gssa1: