Lineage for d6gssa1 (6gss A:77-209)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3694Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 3695Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 3696Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (2 proteins)
  6. 3697Protein Glutathione S-transferase [47618] (22 species)
  7. 3768Species Human (Homo sapiens), class pi [TaxId:9606] [47619] (30 PDB entries)
  8. 3788Domain d6gssa1: 6gss A:77-209 [17534]
    Other proteins in same PDB: d6gssa2, d6gssb2

Details for d6gssa1

PDB Entry: 6gss (more details), 1.9 Å

PDB Description: human glutathione s-transferase p1-1, complex with glutathione

SCOP Domain Sequences for d6gssa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gssa1 a.45.1.1 (A:77-209) Glutathione S-transferase {Human (Homo sapiens), class pi}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOP Domain Coordinates for d6gssa1:

Click to download the PDB-style file with coordinates for d6gssa1.
(The format of our PDB-style files is described here.)

Timeline for d6gssa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6gssa2