Lineage for d3ezjh1 (3ezj H:6-119)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 2744123Domain d3ezjh1: 3ezj H:6-119 [175326]
    Other proteins in same PDB: d3ezjb2, d3ezjb3, d3ezjd2, d3ezjd3, d3ezjf2, d3ezjf3, d3ezjh2, d3ezjh3
    automated match to d1ol0a_
    complexed with cl, po4

Details for d3ezjh1

PDB Entry: 3ezj (more details), 2.8 Å

PDB Description: crystal structure of the n-terminal domain of the secretin gspd from etec determined with the assistance of a nanobody
PDB Compounds: (H:) nanobody nbgspd_7

SCOPe Domain Sequences for d3ezjh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ezjh1 b.1.1.1 (H:6-119) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqaggslrlscaasgsifsinsmdwdrqapgkqrelvatitsggstnyadsvkg
rftisrdnakntvylqmnslkpedtavyycnanvktwagmtrdywgqgtqvtvs

SCOPe Domain Coordinates for d3ezjh1:

Click to download the PDB-style file with coordinates for d3ezjh1.
(The format of our PDB-style files is described here.)

Timeline for d3ezjh1: