PDB entry 3ezj

View 3ezj on RCSB PDB site
Description: Crystal structure of the N-terminal domain of the secretin GspD from ETEC determined with the assistance of a nanobody
Class: protein transport
Keywords: general secretory pathway, secretin, single chain antibody, protein transport, immune system, complex
Deposited on 2008-10-22, released 2009-02-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.194
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: General secretion pathway protein GspD
    Species: Escherichia coli [TaxId:316401]
    Gene: gspD
    Database cross-references and differences (RAF-indexed):
    • Uniprot B3IFK0
      • engineered (41)
  • Chain 'B':
    Compound: nanobody nbgspd_7
    Species: LAMA GLAMA [TaxId:9844]
    Gene: NBGSPD_7
    Database cross-references and differences (RAF-indexed):
    • PDB 3EZJ (0-End)
    Domains in SCOPe 2.07: d3ezjb1, d3ezjb2
  • Chain 'C':
    Compound: General secretion pathway protein GspD
    Species: Escherichia coli [TaxId:316401]
    Gene: gspD
    Database cross-references and differences (RAF-indexed):
    • Uniprot B3IFK0
      • engineered (41)
  • Chain 'D':
    Compound: nanobody nbgspd_7
    Species: LAMA GLAMA [TaxId:9844]
    Gene: NBGSPD_7
    Database cross-references and differences (RAF-indexed):
    • PDB 3EZJ (0-End)
    Domains in SCOPe 2.07: d3ezjd1, d3ezjd2
  • Chain 'E':
    Compound: General secretion pathway protein GspD
    Species: Escherichia coli [TaxId:316401]
    Gene: gspD
    Database cross-references and differences (RAF-indexed):
    • Uniprot B3IFK0
      • engineered (41)
  • Chain 'F':
    Compound: nanobody nbgspd_7
    Species: LAMA GLAMA [TaxId:9844]
    Gene: NBGSPD_7
    Database cross-references and differences (RAF-indexed):
    • PDB 3EZJ (0-End)
    Domains in SCOPe 2.07: d3ezjf1, d3ezjf2
  • Chain 'G':
    Compound: General secretion pathway protein GspD
    Species: Escherichia coli [TaxId:316401]
    Gene: gspD
    Database cross-references and differences (RAF-indexed):
    • Uniprot B3IFK0
      • engineered (41)
  • Chain 'H':
    Compound: nanobody nbgspd_7
    Species: LAMA GLAMA [TaxId:9844]
    Gene: NBGSPD_7
    Database cross-references and differences (RAF-indexed):
    • PDB 3EZJ (0-End)
    Domains in SCOPe 2.07: d3ezjh1, d3ezjh2
  • Heterogens: PO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ezjB (B:)
    qvqlqesggglvqaggslrlscaasgsifsinsmdwdrqapgkqrelvatitsggstnya
    dsvkgrftisrdnakntvylqmnslkpedtavyycnanvktwagmtrdywgqgtqvtvss
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ezjB (B:)
    qvqlqesggglvqaggslrlscaasgsifsinsmdwdrqapgkqrelvatitsggstnya
    dsvkgrftisrdnakntvylqmnslkpedtavyycnanvktwagmtrdywgqgtqvtvss
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ezjD (D:)
    qvqlqesggglvqaggslrlscaasgsifsinsmdwdrqapgkqrelvatitsggstnya
    dsvkgrftisrdnakntvylqmnslkpedtavyycnanvktwagmtrdywgqgtqvtvss
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ezjD (D:)
    qvqlqesggglvqaggslrlscaasgsifsinsmdwdrqapgkqrelvatitsggstnya
    dsvkgrftisrdnakntvylqmnslkpedtavyycnanvktwagmtrdywgqgtqvtvss
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3ezjF (F:)
    qvqlqesggglvqaggslrlscaasgsifsinsmdwdrqapgkqrelvatitsggstnya
    dsvkgrftisrdnakntvylqmnslkpedtavyycnanvktwagmtrdywgqgtqvtvss
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ezjF (F:)
    qvqlqesggglvqaggslrlscaasgsifsinsmdwdrqapgkqrelvatitsggstnya
    dsvkgrftisrdnakntvylqmnslkpedtavyycnanvktwagmtrdywgqgtqvtvss
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3ezjH (H:)
    qvqlqesggglvqaggslrlscaasgsifsinsmdwdrqapgkqrelvatitsggstnya
    dsvkgrftisrdnakntvylqmnslkpedtavyycnanvktwagmtrdywgqgtqvtvss
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ezjH (H:)
    qvqlqesggglvqaggslrlscaasgsifsinsmdwdrqapgkqrelvatitsggstnya
    dsvkgrftisrdnakntvylqmnslkpedtavyycnanvktwagmtrdywgqgtqvtvss