SCOPe 2.01: Domain d3ezjh_: 3ezj H:

Lineage for d3ezjh_ (3ezj H:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (11 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (12 PDB entries)

8. Domain d3ezjh_: 3ezj H: [175326]
   automated match to d1ol0a_
   complexed with cl, po4

Details for d3ezjh_

PDB Entry: 3ezj, 2.8 Å

PDB Description: crystal structure of the n-terminal domain of the secretin gspd from etec determined with the assistance of a nanobody

PDB Compounds: (H:) nanobody nbgspd_7

SCOPe Domain Sequences for d3ezjh_:

Sequence; same for both SEQRES and ATOM records:

>d3ezjh_ b.1.1.1 (H:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlqesggglvqaggslrlscaasgsifsinsmdwdrqapgkqrelvatitsggstnya
dsvkgrftisrdnakntvylqmnslkpedtavyycnanvktwagmtrdywgqgtqvtvss

Timeline for d3ezjh_:

• d3ezjh_ is new in SCOPe 2.01-stable
  
• d3ezjh_ appears in SCOPe 2.02
  
• d3ezjh_ appears in the current release, SCOPe 2.08, called d3ezjh1