SCOPe 2.08: Domain d3ek6b_: 3ek6 B:

Lineage for d3ek6b_ (3ek6 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (4 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.0: automated matches [191466] (1 protein)
   not a true family

6. Protein automated matches [190728] (15 species)
   not a true protein

7. Species Xanthomonas campestris pv. campestris [TaxId:340] [188705] (2 PDB entries)

8. Domain d3ek6b_: 3ek6 B: [175003]
   Other proteins in same PDB: d3ek6a2
   automated match to d2bnda1

Details for d3ek6b_

PDB Entry: 3ek6, 2.34 Å

PDB Description: Unique GTP-binding Pocket and Allostery of UMP Kinase from a Gram-Negative Phytopathogen Bacterium

PDB Compounds: (B:) uridylate kinase

SCOPe Domain Sequences for d3ek6b_:

Sequence; same for both SEQRES and ATOM records:

>d3ek6b_ c.73.1.0 (B:) automated matches {Xanthomonas campestris pv. campestris [TaxId: 340]}
mselsyrrillklsgealmgdgdygidpkvinrlahevieaqqagaqvalvigggnifrg
aglaasgmdrvtgdhmgmlatvinalamqdaleklgakvrvmsaikindvcedfirrrai
rhlekgriaifaagtgnpffttdsgaalraieigadlllkatkvdgvydkdpkkhsdavr
ydsltydevimqglevmdtaafalardsdlplrifgmsepgvllrilhgaqigtlvqgrs

Timeline for d3ek6b_:

• d3ek6b_ first appeared in SCOPe 2.01
  
• d3ek6b_ appears in SCOPe 2.07